“I suffer all these because of periods” Heartbreaking Njambi Koikai’s revelation about her condition

September 11, 2017 at 11:04
“I suffer all these because of periods” Heartbreaking Njambi Koikai’s revelation about her condition

The Trend panelist Njambi Koikai has been in and out of hospitals because of the two conditions she suffers from – Endometriosis and Pneumothorax.

A pneumothorax is an abnormal collection of air in the pleural space between the lung and the chest wall [sic]. Sometimes in February 2016 Njambi was rushed to hospital after her lungs collapsed.

Also read: The Trend’s Panelist Njambi Koikai Wheeled into Surgery after Her Lung Collapses (PHOTO)

Njambi is currently recuperating at Avenue Hospital after she suffered from Endometriosis – a condition in which the layer of tissue that normally covers the inside of the uterus, grows outside it most often on the ovaries, fallopian tubes, and tissue around the uterus and ovaries causing pelvic pain. [sic].

The main symptoms of Endometriosis are pelvic pain and infertility. Nearly half of those affected have chronic pelvic pain, while in 70% pain occurs during menstruation. Pain during sex is also common. Infertility occurs in up to half of women affected. [sic]

Njambi opened up about her condition on Instagram from her hospital bed; she also implored the government to be serious about women’s reproductive health.

Below is what Njambi wrote:

Yoh fam so right after sharing about my recovery process, I was taken critical back to hospital on Monday. All the water in my lungs hadn’t completely drained. Oxygen mask fitted because my saturation was low. Theatre in the night. Chest tube fitted and back to the start. Constipation due to the meds I’ve been taking. All these because of periods. Just periods. I’m not alone. Millions of women are suffering because of MENSTRUATION. Getting babies is not the solution because we know of mothers still suffering. I’d like to encourage mothers to young girls to start taking them to gynaecologists as soon as they get their first period. It is important for women to take charge of their reproductive health. It’s important for govt and the Ministry of Health to take our health seriously and reproductive health. I’d also like to share this with the First Lady who runs the Beyond Zero campaign. Many of our women are suffering because of endometriosis and therefore are not even able to carry pregnancies to full terms. The miscarriages. The mortality rates. I also don’t see any Presidential Candidates addressing our health sector or women’s health.

Imagine 170 million women are suffering worldwide. Our gynaecologists here have no better prescription other than get a child and the condition will go.

I’d like to urge other women to have gynaecologist visits every so often. This is a manifestation of all my teenage years as menstruating woman.

This condition can get you at any age. It can affect you even if you have never suffered from painful periods. We are consuming food high in oestrogen. Watch out what you eat. Watch out the perfumes you wear. Research about parabens.

Get closer to God because the fiercest battles are not given to the weakest.

God is lifting us.

God is raising a new generation

We shall continue to speak of His goodness and mercy.

Thanking my doctors. Dr. Gakinya @wagakinyas Dr.Odula Dr.Mohinga and the entire staff at Avenue Hospital.

Thanks to my fam and my FRIENDS.

I’d like to send a special shout out to Azi. Azi has been massaging and helping me with my breathing exercises. He’s helpedme to relax my muscles and get some sleep without anxiety attacks.

 

 

Comments

  1. Michael wanjohi kigano : September 11, 2017 at 11:29 am

    Quick recovery njambi koikai

  2. Genevieve Masira : September 11, 2017 at 11:37 am

    Pole sana sis you will be well

  3. God will heal you in Jesus name,amen

  4. Quickest Recovery to you dear

  5. Festus Wangombe : September 11, 2017 at 11:42 am

    Pole sana Njambi,will pray for you

  6. Get well soon sister

  7. Quick recovery, you will be okay

  8. Get well soon Njambi

  9. Quick recovery Njambi!

  10. TIMOTHY MURIITHI : September 11, 2017 at 12:05 pm

    Wishing you a quick recovery njambi

  11. Prayin for your recovery gal

  12. Lindsay Ignatius : September 11, 2017 at 12:10 pm

    Get well dear Allah is under control

  13. ashraffunissa mutuku : September 11, 2017 at 12:10 pm

    Quick recovery

  14. Quick recovery Njambi

  15. Receive your healing in Jesus name

  16. Quick recovery sister .. It’s just a wind inapita all will be well in Jesus name

  17. Quick recovery gal

  18. No wonder i don’t listen to reggae tune nowadays, sorry all gonna be alright Njambi just have faith.

  19. God is in control,i wish you quick recovery my sister

  20. Pole sana and thanks for the info.

  21. Quick recovery Empress number 1…#Bless

  22. Aki faya mama Mungu atakuponya.nakutambua sana ukiwa metro fm.

  23. Quick recovery, all will be well my dear. Pole sana

  24. Quick recovery Jambi

  25. Get well honey

  26. Cecilia wanjohi : September 11, 2017 at 4:03 pm

    Get well soon Njambi… Jehovah rapha is our healer. AMEN

  27. Quick recovery to you.its about time women reproductive health was made a top priority.

  28. Get well soon gal.

  29. Get well soon Njambi

  30. Quick recovery dear.It is well Njambi.U have been a good client to me n I miss u sooo much.May the Peace of the Lord be with u.

  31. Njoki we are with you in prayers. Quick recovery.

  32. Quick recovery njambi

  33. Wish you the most speedy recovery, Angles of healing and restoration are on full guard.

  34. Quick recovery njambi

  35. Get well soon Njambi

  36. Quick recovery njambi.

  37. I’ve known you for being a strong girl dear..
    God will see you through,, we love you Njambi

  38. Receive healing in Jesus name dear

  39. Pole sana, and I hope you are better now.
    Could I suggest that you try on Organo Gold products, they work magic. I have always suffered from severe menstrual pains…and they Got worse when arthritis put me down for more than a year.
    My sister in law also suffered from painful periods…but since we tried the Organo gold products I am still not able to explain on the miracles we have experienced.

  40. Get well soon Njambi in Jesus name.Amen

  41. Quick recovery and may God touch you with His healing hand

  42. Quick recovery from the village family kisumu,it has been too long since we danced in your reggae show,most high will see you through..

  43. Njambi Jah is still alive He wont leave u get well soon

  44. Lots of love to you fighter! You are now in my intercession. You’ll be alright Fire Mama!
    PS: If you’d love to write a BOOK about it, reach out to me: njokarimi at gmail dot com. You’ll only need to talk when you can and I’ll do the rest for you.

    It’ll be nice to get word out to our girls and women. I suffered cramps as a teen, a doctor told me to “get a baby”, and I just think I got lucky— not sure, the pain is minimal 2 kids later.

  45. Jah will watch over you enpress. Quick recovery.

  46. Get well soon empress.

  47. May Allah grant you shifaa my sister,Utapona in Shaa Allah

  48. Get well dear sister. God will fight for you.

  49. Quick recovery Njambi thank you for sharing your story

  50. Get well soonest Njambi. Sending you lots of love

  51. Quick recovery…

  52. This is touching. Get well soon dada.

  53. Quick recovery gal.I also experience those pains and im yet to get proper medication.if any share pls

  54. Fyah Mama…get well soon n hit back our reggae queen!

  55. The fiercest battles are not given to the weakest… Get well soon Njambi.

  56. Wishing you quick recovery.may the peace of the Lord be upon you.

  57. Quick recovery…May God see you through in Jesus name

  58. God av a gud plan fo u n fo aving faith in God

  59. You are such a strong girl. Indeed God let’s us fight battles that we can. Wish you a quick recovery.

  60. Trust in the Good Lord and pray. His healing power will enable you to get well soon. Our prayers for your your quick recovery

  61. Get well soon God above all your healed in Jesus name Amen

  62. Quick recovery. You are an inspiration to me and other women suffering from endometriosis. May God continue giving us the strength to face each day.

  63. my thoughts and prayers are with you Njambi aka FAYA MOMMA ..get well soon

  64. Wishing you quick recovery faya mama, we miss you.I pray God’s healing upon you.

  65. May our Good Lord heal you dear. Never give up he is on the throne.Get well soon.love you Njambi.

  66. […] when her lungs collapsed. Fast forward to early September 2017, the Trend panelist was once again admitted to hospital after her condition got […]

  67. It is really a great and useful piece of info. I am glad that you shared this helpful information with us. Please keep us up to date like this. Thanks for sharing.

    http://blog.m2tv.ru/blog/274498.html

  68. Peninah simel : October 13, 2017 at 9:06 pm

    Hi I’m moved by your resilience.I’m also suffering from the same condition kindly how can I hook up with you?

  69. Douglas saruni : November 14, 2017 at 7:27 am

    Pole sana fire mama Jambi mc wangu mkali . nakutambua kwa sana. All will be well with God . Jah guide.

  70. Njoki… Love your presence on The Trend. Your story, albeit sad, is an eye opener…the unspoken. You are a fighter and I wish you well. Hope to share the info with the many teenage girls I interact with in my profession,as well as their parents. Blessings girl. With God, it shall be well.

  71. quick recover jah know his people

  72. Ephraim Mugambi mbae : November 21, 2017 at 5:52 pm

    so hearting get well soon fire mama

  73. get well faya mama in jesus name

  74. CAROLINE MWENDE : February 22, 2018 at 2:10 pm

    quick recovery njambi my the Lord heal you

  75. quick recovery njambi may u get well soon in Jesus name

  76. Eric Gloff Shimosi : March 21, 2018 at 12:54 pm

    Quick recovery Njambi Koikai…The almighty God is wayching you recoevering son and back to your health..We miss yah rhymes ..

  77. njash alkalyne : March 21, 2018 at 11:40 pm

    qr mama njambi

  78. njash alkalyne : March 21, 2018 at 11:41 pm

    Qr

  79. Jossaih Gatabi : April 11, 2018 at 12:32 pm

    May God’s grace be with you Fire Mama…you’re my WCW ..let’s keep balling in Grace and Praying in tongues for you…QR in Jesus name!

  80. kelly mwirigi : April 13, 2018 at 8:37 am

    Pole faya mama… May God heal you and devil is a lier

  81. May angels of healing locate you in Jesus Name.

  82. GOD BE WITH YOU MY DEAR.

  83. MOSES MATHO : July 27, 2018 at 2:54 pm

    get well xun jamb aka fire mama jambi we still miss u on air for the reggae programm back here in kenya

  84. MOSES MATHO : July 27, 2018 at 2:58 pm

    my sister also alot of pain during menstruation and when she visited the hospital she is told to have a baby and the condition will be over she has been in this condition for last three years she had also visited cancer scree screening but no signs of cancer could this be the same as your condition?
    kindly advise

  85. Bramwel Olela : August 2, 2018 at 2:28 pm

    get well soon njambi

  86. Pole sana my dear sister. Wishing you speed recovery in Jesus name.

  87. quick recovery Njambi..put God first.. God does not give his battles to the weak ones

  88. We stumbled over here coming from a different page and thought I might as well check things out. I like what I see so now i’m following you. Look forward to looking into your web page for a second time.

  89. juicy couture online : September 12, 2018 at 5:55 am

    A comfortable old age is the reward of a well-spent youth. Instead of its bringing sad and melancholy prospects of decay, it would give us hopes of eternal youth in a better world. Maurice Chevalier
    juicy couture online https://juicycouture.compucelunlock.net

  90. ugg black friday : September 12, 2018 at 5:55 am

    Very cool, some wonderful points! I appreciate you making this post available, the rest of your site is also well done. I hope you have a great day.
    ugg black friday https://www.cheapugg.cc

  91. adidas online shop : September 12, 2018 at 5:55 am

    I must confess that Ive gotten a bit distracted going through and reading a number of your posts I ought to probably be doing work. Youve got some good observations here, so I will add you to my Google Reader for the future. Take care! colon cleansing
    adidas online shop https://adidas.kmmits.com

  92. Sergio Rossi online store : September 12, 2018 at 7:57 am

    My brother suggested I might like this blog. He was entirely right. This post actually made my day. You can not imagine simply how much time I had spent for this information! Thanks!

  93. furla bags online : September 12, 2018 at 3:10 pm

    Facebook login facebook login facebook login facebook login facebook login.
    furla bags online https://www.furlaoutlet.cc

  94. new balance 80% off : September 12, 2018 at 3:10 pm

    octfkvsmtlicakpcnreqdthkdhvnnmqsk
    new balance 80% off https://www.long-beach-air-conditioning.com/new-balance/

  95. adidas outlet coupon : September 12, 2018 at 3:10 pm

    A splendid article, I just given this onto a colleague who was doing a little analysis on this. And he in fact purchased me lunch because I found it for him :). So let me rephrase that: Thanks for the treat! But yeah Thankx for taking the time to talk about this, I feel strongly about it and enjoy learning more on this topic. If possible, as you become expertise, would you mind updating your blog with more info? It is extremely helpful for me. Two thumb up for this article!
    adidas outlet coupon https://adidas.dunbarmoravia.com

  96. nike outlet sale : September 12, 2018 at 3:11 pm

    Between me and my husband weve owned more MP3 players over the years than I can count, including Sansas, iRivers, iPods (classic & touch), the Ibiza Rhapsody, etc. But, the last few years Ive settled down to one line of players. Why? Because I was happy to discover how well-designed and fun to use the underappreciated (and widely mocked) Zunes are.
    nike outlet sale https://thaismatsura.com/nike/

  97. asics ebay store : September 12, 2018 at 3:11 pm

    This is some good quality stuff. It took me some time to locate this site but it was worth the time. I noticed this post was buried in bing and not the first spot. This website has a ton of decent stuff and it does not deserve to be burried in the search engines like that. By the way I am going to add this web site to my list of favorites.
    asics ebay store https://asics.hawksportsind.com

  98. fitflop shoes sale : September 12, 2018 at 3:11 pm

    Here is some strong info in respect to.
    fitflop shoes sale https://www.fitflopsale.store

  99. fitflop outlet store : September 12, 2018 at 3:12 pm

    Thanks for sharing this helpful info!
    fitflop outlet store https://www.fitfloponline.store

  100. ralph lauren on sale : September 12, 2018 at 3:12 pm

    Quite interesting. I really loved going to your website. Many thanks.
    ralph lauren on sale https://www.ralphlaurensales.cc

  101. cheap belstaff jackets : September 12, 2018 at 3:12 pm

    Were a group of volunteers and opening a new scheme in our community. Your web site provided us with valuable info to work on. You have done an impressive job and our entire community will be grateful to you.
    cheap belstaff jackets https://belstaff.ttravelmint.com

  102. cole haan boots sale : September 12, 2018 at 3:13 pm

    Hai bisogno di scaricare musica gratis?! Visita questo sito web. Cerchi musica gratis su internet?
    cole haan boots sale https://www.colehaanoutlet.online

  103. Authentic puma Outlet : September 12, 2018 at 3:13 pm

    Noble Stennett
    Authentic puma Outlet https://www.websila.us/puma/

  104. giorgio armani store : September 12, 2018 at 3:13 pm

    I recently came across your blog and have been reading along. I thought I would leave my very first remark. Nice blog. I will keep visiting this blog very often. I really have to say thanks
    giorgio armani store https://www.armanisale.store

  105. Lafuma jackets online : September 12, 2018 at 3:14 pm

    It isnt unexpected for to be exclusive.
    Lafuma jackets online https://www.lafumaonline.cc

  106. discount puma shoes : September 12, 2018 at 3:14 pm

    This web site is really a stroll-by way of for all the information you needed about this and didn’t know who to ask. Glimpse here, and also you’ll undoubtedly discover it.
    discount puma shoes https://missaototustuus.com/puma/

  107. barbour outlet online : September 12, 2018 at 3:14 pm

    You must stop smoking read about the effects.
    barbour outlet online https://barbour.vidaaposvinte.com

  108. cheap asics gel lyte iii : September 12, 2018 at 3:14 pm

    I have read a few of the articles on your web page currently, and I like your style of blogging. I added it to my favorites blog listing and will also be checking back soon. Take a look at my site as well and let me know what you think.
    cheap asics gel lyte iii https://asics.siargaoislandadventures.com

  109. kendrick lamar reebok for sale : September 12, 2018 at 3:15 pm

    Wow Im frustrated. Im not pointing fingers at you though, I think it is everyone else out there that isnt taking notice.
    kendrick lamar reebok for sale https://reebok.siargaoislandadventures.com

  110. berghaus for sale : September 12, 2018 at 6:09 pm

    Realy good work cheers mate!
    berghaus for sale https://www.berghaussale.cc

  111. Rene Caovilla store online : September 12, 2018 at 6:09 pm

    These kind of post are always inspiring and I prefer to read quality content so I happy to find many first-rate point here in the post, writing is simply great, thank you for the post
    Rene Caovilla store online https://www.renecaovillastore.cc

  112. Thank you for another great article. Where else could anyone get that kind of information in such a perfect way of writing? I have a presentation next week, and I am on the look for such information.
    New puma Store https://puma.noorunalaanoor.net

  113. Christian Louboutin outlet online : September 12, 2018 at 6:10 pm

    I have to make concessions on creating the impression of being unhappy.
    Christian Louboutin outlet online https://christianlouboutin.compucelunlock.net

  114. reebok boxing shoes : September 12, 2018 at 6:10 pm

    I cling on to listening to the news talk about receiving free online grant applications so I have been looking around for the most excellent site to get one. Could you advise me please, where could i get some?
    reebok boxing shoes https://www.ontrackracingexperience.com/reebok/

  115. merrell sandals sale : September 12, 2018 at 6:10 pm

    Wow, simply changed into aware of your post through Bing, and located that it is really informative. I’m gonna watch out for brussels. I’ll appreciate for those who proceed this in future. Lots of other people will be benefited from your post. Thanks in advance
    merrell sandals sale https://merrell.kmmits.com

  116. Stuart Weitzman online : September 12, 2018 at 6:10 pm

    Mistakes are a part of being human. Appreciate your mistakes for what they are: precious life lessons that can only be learned the hard way. Unless its a fatal mistake, which, at least, others can learn from.
    Stuart Weitzman online https://stuartweitzman.artienatasha.com

  117. discount louis vuitton bags : September 12, 2018 at 6:11 pm

    Its Pleasure to realize your blog.The above articles is relatively extraordinary, and I extremely enjoyed reading your blog and points that you expressed. I incredibly like to glimpse back on a typical basis,post additional during the topic.Thanks for sharingkeep writing!!!
    discount louis vuitton bags https://www.handbagsoutlet.online

  118. fjallraven outlet : September 13, 2018 at 12:33 am

    This is some good quality stuff. It took me some time to locate this site but it was worth the time. I noticed this post was buried in bing and not the first spot. This website has a ton of decent stuff and it does not deserve to be burried in the search engines like that. By the way I am going to add this web site to my list of favorites.

  119. reebok outlet store near me : September 13, 2018 at 6:33 am

    bove coll bittercreek salvietti nino rufino aud parely snappish
    reebok outlet store near me https://reebok.stefanzeulner.com

  120. adidas employee discount : September 13, 2018 at 6:34 am

    This is some good quality stuff. It took me some time to unearth this site but it was worth the time. I noticed this post was buried in google and not the first spot. This internet site has a ton of high-quality stuff and it does not deserve to be burried in the search engines like that. By the way I am going to save this website to my list of favorites.
    adidas employee discount https://construmetria.com/adidas/

  121. I want really know your attitude, respectively get approved, if you knowit is not allowed to download videos and Music from Youtube.
    buy marmot https://www.marmotshop.online

  122. oakley shooting glasses : September 13, 2018 at 8:11 am

    splatter father shares mobile frayne tales behind cron arabesque
    oakley shooting glasses https://oakley.unilorites.com

  123. cole haan outlet orlando : September 13, 2018 at 8:11 am

    Im a huge fan already, man. Youve done a brilliant job making sure that people understand where youre coming from. And let me tell you, I get it. huge stuff and I cant wait to check out more of your websites. What youve got to say is important and needs to be read.
    cole haan outlet orlando https://colehaan.unilorites.com

  124. Callaway Golf sale : September 13, 2018 at 8:11 am

    I completely adore reading your blog posts, the selection of articles are smashing.This blog was academic, Ive needed to bookmark your site and subscribe to your feed in ifeed. Your theme appears lovely.
    Callaway Golf sale https://www.callawaygolfsale.online

  125. Hot new balance Clearance : September 13, 2018 at 8:12 am

    Hello! Just dropped by to write great website. Keep up the good work youre doing!
    Hot new balance Clearance https://www.mcadamssupplyco.com/new-balance/

  126. north face x supreme : September 13, 2018 at 5:17 pm

    Are all of these articles written yourself or did you hire a writer?

  127. cole haan store nyc : September 13, 2018 at 7:28 pm

    When I start your Rss feed it seems to be a lot of junk, is the problem on my part?
    cole haan store nyc https://www.colehaanoutlet.store

  128. emu outlet store : September 13, 2018 at 7:28 pm

    Just, admirable what you might have done here. It truly is pleasing to appear you express through the heart along with your clarity on this considerable subject material may be simply looked. Outstanding publish and can search forward for your long run update.
    emu outlet store https://emu.websila.us

  129. mont blanc store locator london : September 13, 2018 at 7:29 pm

    Concise and well written, thank you for the data. Do you care if I post some of this on my site basically incorporate a reference to this site?
    mont blanc store locator london https://www.voogue.co.uk

  130. cheap ralph lauren sale : September 13, 2018 at 7:29 pm

    Can I reference part of this on my webpage if I post a backlink to this web page?
    cheap ralph lauren sale https://droos.org/ralph-lauren/

  131. Howdy this is kind of of off topic but I was wanting to know if blogs use WYSIWYG editors or if you have to manually code with HTML. Im starting a blog soon but have no coding expertise so I wanted to get guidance from someone with experience. Any help would be enormously appreciated!
    keen store https://keen.unilorites.com

  132. mulberry factory outlet prices : September 13, 2018 at 7:30 pm

    Hello! Just wanted to say blog. Continue with the good work!
    mulberry factory outlet prices https://www.cheapmulberry.com

  133. alexander mcqueen outlet : September 13, 2018 at 7:30 pm

    A topic close to my heart many thanks, i have been thinking about about this subject for some time.
    alexander mcqueen outlet https://www.alexandermcqueenoutlet.store

  134. Factory puma Online : September 13, 2018 at 7:30 pm

    If you are open to having a guest blog poster please reply and let me know. I will provide you with unique content for your blog, thanks.
    Factory puma Online https://vidaaposvinte.com/puma/

  135. cheap cole haan shoes : September 13, 2018 at 7:30 pm

    This is the nice info. Thanks
    cheap cole haan shoes https://www.colehaanoutlet.online

  136. north face purple label : September 13, 2018 at 7:31 pm

    Very good written story. It will be beneficial to anyone who utilizes it, as well as me. Keep up the good work looking forward to more posts.
    north face purple label https://northface.vidaaposvinte.com

  137. Cheap puma Clearance : September 13, 2018 at 7:31 pm

    Im no professional, but I feel you just crafted the best point. You naturally understand what youre talking about, and I can actually get behind that. Thanks for staying so upfront and so truthful.
    Cheap puma Clearance https://www.francarrilloguerrero.com/puma/

  138. adidas ultra boost sale : September 13, 2018 at 7:31 pm

    Its Pleasure to realize your blog.The around articles is fairly extraordinary, and I very enjoyed reading your blog and points that you simply expressed. I extremely like to look back on a typical basis,post much more during the topic.Thanks for sharingkeep writing!!!
    adidas ultra boost sale https://adidas.benefitsofvitamins.org

  139. marmot for cheap : September 13, 2018 at 7:32 pm

    Stubbmled accross your blog and decided to have a very quick study, not what I usually do, but I found this blog excellent. Great to see a web site that has great content, and actually makes some sense. Anyway, great write up.
    marmot for cheap https://marmot.kmmits.com

  140. Do you care if I put some of this on my website if I include a backlink to this page?
    Balmain sale https://www.possion.co.uk

  141. mammut jackets sale : September 14, 2018 at 12:51 am

    I really like your writing style, fantastic info , regards for putting up : D. Houston Tantra Tantric Sexuality 3131 Memorial Ct. Suite 301 Houston, TX 77007 (832) 615 6464
    mammut jackets sale https://www.mammutsale.cc

  142. ugg flip flop slippers : September 14, 2018 at 12:51 am

    Wow, greet post !
    ugg flip flop slippers https://www.uggcheap.cc

  143. factory balmain outlet : September 14, 2018 at 12:52 am

    Thanks a lot for taking the time to discuss this, I feel strongly about it and love learning more on this subject. If possible, as you gain expertise, would you mind updating your web site with more information? It is extremely helpful for me. My best wishes, Willodean.
    factory balmain outlet https://www.balmainoutlet.cc

  144. ralph lauren polo online : September 14, 2018 at 12:52 am

    Howdy, I honestly similar to this journal as being the writings put up newest and genuinely fascinating tales..The internet site design and style is quite uncomplicated, appealing and simple and easy for customers..hold up the great function !
    ralph lauren polo online https://www.poloralphlauren.online

  145. My Payers and Faith are with you Fire Mamma. I Believe that you will get well soonest, you are a very strong and bold lioness…I am proud of you.

  146. I was looking around your site and noticed broken links. You might want to change it.
    sequin uggs https://www.uggoutletstore.cc

  147. Mens puma On Sale : September 14, 2018 at 7:56 am

    When making buys for their urgent food resources, numerous a variety of men and women opt for the already organized food supply plans. These bundles come in unique sizes, based on the amount of members in your family, or the number of people that you have got to feed.
    Mens puma On Sale https://www.spectrumtraveltours.com/puma/

  148. cheap pierre hardy : September 14, 2018 at 7:57 am

    Hi, decent post. I have been pondering this topic, so thanks for sharing. I’ll likely be coming back to your posts. Keep up the superior work
    cheap pierre hardy https://pierrehardy.hawksportsind.com

  149. buy mammut jackets : September 14, 2018 at 7:57 am

    Great article. I was checking continuously to this web site and Im really inspired! Very helpful information, especially the second sentences. I really need this kind of knowledge. I used to be seeking this kind of information for a period. Thankx and best wishes.
    buy mammut jackets https://www.cheapmammut.cc

  150. patagonia returns : September 14, 2018 at 7:58 am

    Thanks for the interesting read! Thank you.
    patagonia returns https://www.patagoniaonsale.cc

  151. Heard about this website from my friend. He pointed me right here and informed me I’d find what I need. He was correct! I acquired all the questions I had, answered. Did not even take long to seek out it. Adore the fact that you made it so simple for individuals like me.
    merrell store https://www.merrellonsale.online

  152. mulberry bag outlet online : September 14, 2018 at 7:58 am

    Television systems are also used for surveillance, industrial process control, and guiding of weapons, in places where direct observation is difficult or dangerous.
    mulberry bag outlet online https://www.cheapmulberry.com

  153. discount Callaway Golf online : September 14, 2018 at 7:59 am

    Howdy! Im planning to build chicken coop, do You know where could I find chicken coop plans? Bye!
    discount Callaway Golf online https://www.callawaygolfoutlet.online

  154. discount LK Bennett online : September 14, 2018 at 7:59 am

    Wow! Thank you! I always wanted to write in my site some thing like that. Can I take part of your publish to my blog?
    discount LK Bennett online https://lkbennett.easyinboxmailer.com

  155. uggs boots outlet : September 14, 2018 at 7:59 am

    Very good suggestions, personally Im gonna have to bookmark this and come back to it. What would you suggest in regards to your post that you made a few days ago?
    uggs boots outlet https://ugg.easyinboxmailer.com

  156. thanks a lot for the great post!
    puma 90% Off https://puma.mataragroup.com

  157. cheap nike air max shoes : September 14, 2018 at 8:00 am

    Nice info. Keep the useful info coming!
    cheap nike air max shoes https://www.easyinboxmailer.com/nike/

  158. This blog has lots of extremely useful stuff on it! Cheers for informing me.
    Millet online https://spectrumtraveltours.com/millet/

  159. nearest adidas store : September 14, 2018 at 8:00 am

    Do you care if I reference thing about this on my site if I post a link back to this website?
    nearest adidas store https://adidas.siargaoislandadventures.com

  160. arcteryx beta ar : September 14, 2018 at 8:00 am

    I used to think I had it bad because I had no , then I met a man with no.
    arcteryx beta ar https://www.arcteryxjackets.online

  161. Hey, I think your really on track with this, I cant say I am completely on the same page, but its not really that big of a issue.

  162. patagonia black hole duffel 60l : September 14, 2018 at 4:33 pm

    Thank you for another news article. Im really excited I was able to find this article, since so many of the blogs Ive been reading have misleading info.
    patagonia black hole duffel 60l https://www.zapposmall.store

  163. discount new balance shoes : September 14, 2018 at 4:34 pm

    you have a great blog here! would you like to make some invite posts on my blog?
    discount new balance shoes https://missaototustuus.com/new-balance/

  164. Id should check with you here. Which is not one thing I normally do! I enjoy studying a post that will make folks think. Additionally, thanks for permitting me to comment!
    male ugg boots https://ugg.websila.us

  165. cheap jimmy choo : September 14, 2018 at 4:34 pm

    nice and enough admirable content just before force me for a comment
    cheap jimmy choo https://jimmychoo.websila.us

  166. hermes store online : September 14, 2018 at 4:35 pm

    I think that is an remarkable point, it made me think a bit. Thank you for sparking my thinking cap. Sometimes I get so much in a rut that I just sense like a record.
    hermes store online https://www.handbagsstyle.online

  167. Victoria's Secret online : September 14, 2018 at 4:35 pm

    I had this website bookmarked some time ago but my laptop crashed. I have since gotten a new one and it took me a while to locate this! I also really like the design though.
    Victoria’s Secret online https://www.victoriassecretonline.store

  168. nike outlet hours : September 14, 2018 at 4:35 pm

    I have had my brand new Apple iphone Four for less than a couple of days now and i should point out that for any individual thinking of getting an phone, just purchase the 3gs. Not only will you save a lot of money but you will probably save yourself a great deal of headaches.
    nike outlet hours https://www.corianderrva.com/nike/

  169. Good post. I will want some time to absorb your article..
    puma 90 off https://puma.tmearegion26.com

  170. mulberry store york : September 14, 2018 at 4:36 pm

    I agree, thanks for sharing this..
    mulberry store york https://www.cheapmulberry.cc

  171. asics shoes online : September 14, 2018 at 4:36 pm

    Nice write-up, I am an enormous believer in commenting on blogs to help the blog writers know that they’ve added something worthwhile to the world huge net! (supply roblox-cheats.com). Anyway, in my language, there are usually not a lot good source like this.
    asics shoes online https://www.angigreene.com/asics/

  172. cheap asics running shoes : September 14, 2018 at 4:37 pm

    Very good post. Ive really enjoyed visiting your blog posts. In any case I’ll be subscribing to your feed and I hope you write again soon! Thanks a lot, I’ll try and visit more often. Happy new year!
    cheap asics running shoes https://appanageinvestments.com/asics/

  173. Cheap puma Outlet : September 14, 2018 at 4:37 pm

    We like your post, the point that your web site is definitely a tiny bit diverse makes it so fascinating, I actually get fed up of seeing the same outdated tedious recycled stuff almost all of the time.
    Cheap puma Outlet https://hartlaubinsurance.com/puma/

  174. patagonia clearance : September 14, 2018 at 4:38 pm

    Keep working, great post! Just what I had to know.
    patagonia clearance https://patagonia.vidaaposvinte.com

  175. Because of reading your blog, I made a decision to create my very own. Id never been thinking about keeping a blog until I saw how fun yours was, then I was inspired!
    ecco outlet https://www.cheapecco.cc

  176. porethose
    outlet nike https://nike.noorunalaanoor.net

  177. nike roshe sale : September 14, 2018 at 4:38 pm

    Thank you a lot for your interesting text. I have been looking for such message for a very long time. Not everything is fully easy to understand to me, even though it is definitely interesting and worth reading.
    nike roshe sale https://www.enviatuequipaje.com/nike/

  178. nike outlet coupon in store : September 14, 2018 at 4:39 pm

    A low semen volume analysis examines certain characteristics of a males low semen and the amount of sperm that is contained in the semen fluid volume. It may be done while investigating a couples infertility or maybe after a vasectomy to verify that the procedure was successful. It is also used for testing the donors for ejaculation fluid donation. Lately its really possible to produce more sperm with really safe and natural ways like buying natural pills from the many online shops.
    nike outlet coupon in store https://nike.hawksportsind.com

  179. Thank you for the great tip, i recently came across your blog and have been reading along.. I mean, her, awesome thoughts
    puma 80% Off https://www.unilorites.com/puma/

  180. Roberto Cavalli outlet store : September 14, 2018 at 4:39 pm

    I thought it was gonna be some boring old publish, but it really paid out for my time. I will article a link to the page in my weblog. I am sure my personal site visitors will finally find that invaluable. . . .
    Roberto Cavalli outlet store https://www.robertocavallistore.online

  181. koolaburra vs ugg : September 14, 2018 at 4:40 pm

    Very good points you wrote here..Great stuffI think youve made some truly interesting points.Keep up the good work.
    koolaburra vs ugg https://www.uggoutlets.cc

  182. asics shoes sale : September 14, 2018 at 4:40 pm

    That is a funny video clip germane to that has something to it.
    asics shoes sale https://www.thefreebaby.com/asics/

  183. cheap Sergio Rossi online : September 14, 2018 at 4:41 pm

    Sick! Just received a brand-new Pearl and I can now read your weblog on my phone’s browser, it didn’t do the job on my old one.
    cheap Sergio Rossi online https://sergiorossi.websila.us

  184. I couldnt currently have asked for a better blog. You happen to be always at hand to present excellent information, going straight away to the point for straightforward understanding of your readers. Youre really a terrific pro in this area. Thanks for always being there for people like me.
    cheap reebok https://vidaaposvinte.com/reebok/

  185. canada goose bird : September 14, 2018 at 4:41 pm

    Who are you to unrestrictedly provide something that provides a detailed explanation in regard to ?
    canada goose bird https://www.canadagooseoutletstore.online

  186. Rene Caovilla outlet : September 14, 2018 at 8:53 pm

    This article is awarded a 2 thumbs up from me.
    Rene Caovilla outlet https://renecaovilla.unilorites.com

  187. cheap asics running shoes : September 14, 2018 at 8:53 pm

    hi, what is the theme you are using?
    cheap asics running shoes https://asics.eklatresearch.com

  188. reebok question for sale : September 14, 2018 at 8:53 pm

    Thank you for an additional terrific write-up. Exactly where else could anyone get that kind of details in this kind of a ideal way of writing? Ive a presentation subsequent week, and Im to the appear for this kind of information and facts.
    reebok question for sale https://www.jeannesgelato.com/reebok/

  189. LK Bennett shoes sale : September 14, 2018 at 8:54 pm

    Damn, awesome site. I in fact discovered this on aol, and im delighted I did. I will without a doubt be coming back here more often. wish i could add to the posts here as well as deliver a bit more to the table, however am just reading and absorbing just as much facts as I can right now.
    LK Bennett shoes sale https://www.lkbennettsale.online

  190. fake michael kors bag : September 14, 2018 at 8:54 pm

    Do you people have a fb fan page? I regarded for one on twitter but could not uncover one, I would really like to grow to be a fan!
    fake michael kors bag https://www.blueheavenboutique.co.uk

  191. Cheap new balance Clearance : September 14, 2018 at 8:54 pm

    Loving the information on this web site , you have done great job on the content .
    Cheap new balance Clearance https://hartlaubinsurance.com/new-balance/

  192. north face outlet near me : September 14, 2018 at 8:55 pm

    Please, can you PM me and tell me few more thinks about this, I am really fan of your bloggets solved properly asap.
    north face outlet near me https://northface.hartlaubinsurance.com

  193. uk stuart weitzman : September 14, 2018 at 8:55 pm

    Perhaps I may not be too amazed by this.
    uk stuart weitzman https://www.dolux.co.uk

  194. cheap canada goose : September 14, 2018 at 8:56 pm

    I am normally hunting for notice. This article gets me thinking. put you in my favorites
    cheap canada goose https://www.factorycanadagooseoutlet.online

  195. jimmy choo online store : September 14, 2018 at 8:56 pm

    Relying on your instanct is tough for most of us. Many of us develop this ability over the course of our life. It doesnt really just happen if you know what I mean.
    jimmy choo online store https://www.jimmychoostore.online

  196. Hi! I found your blog on AOL.Its really comprehensive and it helped me a lot.
    keen sale https://keen.angigreene.com

  197. Factory puma Online : September 14, 2018 at 8:57 pm

    A low semen volume analysis examines certain characteristics of a males low semen and the amount of sperm that is contained in the semen fluid volume. It may be done while investigating a couples infertility or maybe after a vasectomy to verify that the procedure was successful. It is also used for testing the donors for ejaculation fluid donation. Lately its really possible to produce more sperm with really safe and natural ways like buying natural pills from the many online shops.
    Factory puma Online https://www.unilorites.com/puma/

  198. michael kors gift card : September 14, 2018 at 8:57 pm

    Sick! Just obtained a brand-new Pearl and I can now read your weblog on my phone’s browser, it didn’t perform on my old one.
    michael kors gift card https://www.cheapmichaelkors.online

  199. michael kors customer service number : September 14, 2018 at 8:57 pm

    Just keep posting good posts. Conversion Prophet
    michael kors customer service number https://www.mkoutlet.online

  200. adidas outlet near me : September 14, 2018 at 8:58 pm

    Brilliant, thank you, I will subscribe to you RSS now!
    adidas outlet near me https://adidas.didiermaille.com

  201. new balance outlet store : September 14, 2018 at 8:58 pm

    Highly rated post. I learn something totally new on different blogs everyday. Deciding on one . stimulating to read the paper content from different writers and be taught just a little one thing from their website. I’d like to use sure of this content material on my weblog you’re mind. Natually I’ll give a link right here were at your web-site. Appreciate your sharing.
    new balance outlet store https://newbalance.didiermaille.com

  202. discount polo ralph lauren : September 14, 2018 at 8:58 pm

    This site appears to recieve a large ammount of visitors. How do you promote it? It gives a nice unique spin on things. I guess having something real or substantial to give info on is the most important thing.
    discount polo ralph lauren https://www.ralphlaurenoutlets.store

  203. new balance 90% Off : September 15, 2018 at 1:24 am

    Just thought I would comment and say great theme, did you make it on your own? Looks really good!

  204. reebok online coupon : September 15, 2018 at 8:18 am

    I believed it was going to become some dull aged post, but it definitely compensated for my time. Ill publish a hyperlink to this web page on my weblog. Im sure my site visitors will find that very helpful.
    reebok online coupon https://reebok.lipoescultura10.com

  205. I just added this web site to my favorites. I really enjoy reading your posts. Thanks!
    buy hunter https://hunter.kmmits.com

  206. arcteryx rush jacket : September 15, 2018 at 8:19 am

    Please tell me that youre going to keep this up! Its so great and so important. I cant wait to read more from you. I just really feel like you know so substantially and know how to make people listen to what youve to say. This blog is just also cool to be missed. Excellent stuff, seriously. Please, PLEASE keep it up!
    arcteryx rush jacket https://arcteryx.francarrilloguerrero.com

  207. hunter outlet store : September 15, 2018 at 8:19 am

    repeated mujeres talmadge keown eternal mccorrey brigadier excessive latest
    hunter outlet store https://www.hunterstore.online

  208. Roberto Cavalli online : September 15, 2018 at 9:16 am

    It is unusual for me to find something on the net that is as entertaining and intriguing as what youve got here. Your page is lovely, your graphics are great, and whats more, you use source that are relevant to what you are talking about. You are certainly one in a million, good job!
    Roberto Cavalli online https://robertocavalli.unilorites.com

  209. oakley sunglasses outlet : September 15, 2018 at 9:17 am

    Thank you pertaining to sharing the following superb subject matter on your web-site. I came across it on google. I may check to come back once you publish additional aricles.
    oakley sunglasses outlet https://www.oakleyoutlet.cc

  210. herve leger sale dress : September 15, 2018 at 9:17 am

    Wow, greet post !
    herve leger sale dress https://www.blackfridaysale.store

  211. nike factory online : September 15, 2018 at 9:18 am

    You really make it seem so easy with your presentation but I find this topic to be really something which I think I would never understand. It seems too complex and extremely broad for me. Im looking forward for your next post, I’ll try to get the hang of it!
    nike factory online https://nike.compucelunlock.net

  212. asics factory outlet : September 15, 2018 at 9:18 am

    So use the product/products or service personally before you register as an affiliate to see if it can really deliver what it promises there is a lot of stuff out there that does not. If you did this then youre one of the credible and living testaments aware of the advantages and disadvantages to build trust. Your customers will see & feel the sincerity and truthfulness in you and that is what will trigger them to buy & judge for them selves going by your word.
    asics factory outlet https://asics.dunbarmoravia.com

  213. cheap barbour online : September 15, 2018 at 9:19 am

    I didnt understand the concluding part of your article, could you please explain it more?
    cheap barbour online https://barbour.benefitsofvitamins.org

  214. new balance shoes online : September 15, 2018 at 9:19 am

    Hello! I just would like to give a huge thumbs up for the great data youve here on this post. I shall be coming again to your blog for extra soon.
    new balance shoes online https://newbalance.benefitsofvitamins.org

  215. cheap Millet sale : September 15, 2018 at 9:20 am

    This website is the prime web property.
    cheap Millet sale https://droos.org/millet/

  216. Stuart Weitzman 5050 sale : September 15, 2018 at 9:20 am

    i think you have a nice page here today was my initial time coming here.. i just happened to discover it doing a google search. anyway, great post.. ill be bookmarking this page for sure.
    Stuart Weitzman 5050 sale https://www.stuartweitzmansale.online

  217. Cheap Valentino Shoes : September 15, 2018 at 9:21 am

    Once before I found a similar article on another website and didnt quite get it, but your article helped me understand it better. Thanks a lot!
    Cheap Valentino Shoes https://www.valentinooutletonlines.com

  218. cheap balmain jeans : September 15, 2018 at 9:21 am

    Quite a few of the ideas associated with this blog post are excellent yet had myself wanting to know, did they truly mean that? One point I have to say is definitely your authoring abilities are very great and I will probably be returning back for any new post you come up with, you may well have a completely new fan. I saved your main website for reference.
    cheap balmain jeans https://www.baoutlet.store

  219. patagonia mountains : September 15, 2018 at 9:22 am

    For centuries, theologians have been explaining the unknowable in terms of the-not-worth-knowing.
    patagonia mountains https://www.buypatagonia.online

  220. keen outlet online : September 15, 2018 at 9:22 am

    Ive thought about posting something about this before. Good job! Can I use part of your post in my blog?
    keen outlet online https://www.keenoutlet.cc

  221. coach usa bus schedule : September 15, 2018 at 9:22 am

    Thanks for posting this piece of writing. I’m without doubt frustrated with struggling to search out relevant and brilliant commentary on this subject. Everybody now goes to the very far extremes to either drive home their viewpoint that either: everyone else in the planet is wrong, or two that everyone but them does not in actuality understand the situation. Many thanks for your succinct, applicable insight.
    coach usa bus schedule https://www.poollyanna.co.uk

  222. reebok pumps for sale : September 15, 2018 at 9:23 am

    Football betting by players.
    reebok pumps for sale https://reebok.tmearegion26.com

  223. alexander mcqueen sale : September 15, 2018 at 9:23 am

    This is the nice info. Thanks
    alexander mcqueen sale https://www.ebaymall.store

  224. cheap pierre hardy store : September 15, 2018 at 9:24 am

    The next time I come to this blog I will be sure to make better points.
    cheap pierre hardy store https://www.pierrehardystore.cc

  225. giorgio armani suits sale : September 15, 2018 at 9:24 am

    nevena zon paully base fing honors maher barrows Vinita
    giorgio armani suits sale https://www.armanioutlet.cc

  226. ecco shoes outlet store locator : September 15, 2018 at 9:24 am

    I dont know if I see where you are comming from, but do indeed elaborate a little more. Thanks
    ecco shoes outlet store locator https://www.londoon.co.uk

  227. belstaff online store : September 15, 2018 at 9:25 am

    Its amazing how much more attention I aquire from the opposite sex now that I have a beachbody coach!
    belstaff online store https://belstaff.francarrilloguerrero.com

  228. Right on!
    fake oakleys https://www.oakleystore.cc

  229. adidas employee store pass 2017 : September 15, 2018 at 9:26 am

    Its a very good post! i had subscribed your post!Please update the latest information!
    adidas employee store pass 2017 https://www.thefreebaby.com/adidas/

  230. coach eyeglass frames : September 15, 2018 at 9:26 am

    Appreciate writing this. I love the world wide web because you can study something new every day. I’ll share this with my friends, thank you!
    coach eyeglass frames https://www.coachbagsfactoryoutletstore.com

  231. vans x north face : September 15, 2018 at 9:27 am

    POST CLOSED
    vans x north face https://northface.angigreene.com

  232. adidas nmd r1 for sale : September 15, 2018 at 9:27 am

    Good post. I previousally to spend alot of my time water skiing and watching sports. It was quite possible the best sequence of my past and your content kind of reminded me of that period of my life. Cheers
    adidas nmd r1 for sale https://adidas.eklatresearch.com

  233. Alexander Wang Outlet Online : September 15, 2018 at 9:28 am

    Very good write-up,reasonable advice. With thanks a lot =)
    Alexander Wang Outlet Online https://www.newyearoutlet.online

  234. As a newbie to the internet, this info has proved to be particularly helpful. Thanks!
    Lafuma sale https://www.lafumasale.cc

  235. Best new balance Store : September 15, 2018 at 9:29 am

    It certainly does take quite some time to find fantastic information such as this. Thank you very much.
    Best new balance Store https://newbalance.hawksportsind.com

  236. buy birkenstock online : September 15, 2018 at 9:30 am

    very g00d inf0 keep up the work! thanx
    buy birkenstock online https://spectrumtraveltours.com/birkenstock/

  237. I will surely foreward this post to all of my pals! Its very superior and a very fine read!
    cheap asics https://asics.mataragroup.com

  238. cheap asics shoes : September 15, 2018 at 9:31 am

    Remarkable web site, Distinguished comments that I can tackle. I am shifting ahead and might apply to my current job as a pet sitter, which may be very fulfilling, however I must additional expand. All the Best
    cheap asics shoes https://missaototustuus.com/asics/

  239. cheap adidas shoes online : September 15, 2018 at 9:32 am

    i have begun to visit this cool site a couple of times now and i have to say that i find it quite good actually. keep the nice work up! =p
    cheap adidas shoes online https://missaototustuus.com/adidas/

  240. arcteryx beta lt : September 15, 2018 at 9:32 am

    Thanks for the sensible critique. Me & my neighbour were making ready to do a little analysis about that. We obtained a good e book on that matter from our local library and most books where not as influensive as your information. Im very glad to see such information which I was searching for a long time.This made very glad! Anyway, in my language, there usually are not much good source like this.
    arcteryx beta lt https://arcteryx.ttravelmint.com

  241. parajumpers jackets online : September 15, 2018 at 9:33 am

    vandring lauralea georgiana hausen throwing nightcats draper eggerikx clockwinder parenthood possessions shutov functionalist svjetlana
    parajumpers jackets online https://www.buyparajumpers.online

  242. I think this is one of the most important info for me. And im glad reading your article. But should remark on few general things, The website style is great, the articles is really excellent : D. Good job, cheers
    mammut store https://www.mammutstore.cc

Leave a Reply

Your email address will not be published. Required fields are marked *


in Entertainment
Loading...
mm

Ultimate keyboard ninja dedicated to bringing you the juiciest stories on blogosphere